Das SBP-Tag (von englisch Streptavidin binding peptide tag) ist ein Protein-Tag, das in der Biochemie zur Proteinreinigung und zum -nachweis verwendet wird.

Eigenschaften

Das SBP-Tag wird unter anderem zur Affinitätschromatographie und zu Pulldown-Assays verwendet. Es hat die Aminosäuresequenz MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. Das SBP-Tag wurde per mRNA-Display erzeugt.[1] Die Selektion erfolgte im Hochdurchsatz unter Inkubation von einer Peptid-Bibliothek mit Streptavidin-Agarose und einer Elution mit Biotin. Das SBP-Tag bindet an Streptavidin mit einer Dissoziationskonstante von 2,5 nM.[1][2] Die Elution erfolgt durch Zugabe von Biotin unter nativen Bedingungen.[1][2]

Anwendungen

Das SBP-Tag wird unter anderem als einer der beiden Trennschritte im Zuge einer Tandem Affinity Purification verwendet.[3][4]

Einzelnachweise

  1. 1 2 3 David S. Wilson, Anthony D. Keefe, Jack W. Szostak: The use of mRNA display to select high-affinity protein-binding peptides. In: Proceedings of the National Academy of Sciences. 98. Jahrgang, Nr. 7, 2001, S. 3750–5, doi:10.1073/pnas.061028198, PMID 11274392, PMC 31124 (freier Volltext).
  2. 1 2 Anthony D. Keefe, David S. Wilson, Burckhard Seelig, Jack W. Szostak: One-Step Purification of Recombinant Proteins Using a Nanomolar-Affinity Streptavidin-Binding Peptide, the SBP-Tag. In: Protein Expression and Purification. 23. Jahrgang, Nr. 3, 2001, S. 440–6, doi:10.1006/prep.2001.1515, PMID 11722181.
  3. Jelle Van Leene, Dominique Eeckhout, Geert Persiau, Eveline Van De Slijke, Jan Geerinck, Gert Van Isterdael, Erwin Witters, Geert De Jaeger: Plant Transcription Factors. Hrsg.: Ling Yuan, Sharyn E. Perry (= Methods in Molecular Biology. Band 754, Nr. 4). 2011, ISBN 978-1-61779-153-6, Isolation of Transcription Factor Complexes from Arabidopsis Cell Suspension Cultures by Tandem Affinity Purification, S. 195–218, doi:10.1007/978-1-61779-154-3_11, PMID 21720954.
  4. Azlinda Anwar, K. M. Leong, Mary L. Ng, Justin J. H. Chu, Mariano A. Garcia-Blanco: The Polypyrimidine Tract-binding Protein Is Required for Efficient Dengue Virus Propagation and Associates with the Viral Replication Machinery. In: Journal of Biological Chemistry. 284. Jahrgang, Nr. 25, 2009, S. 17021–9, doi:10.1074/jbc.M109.006239, PMID 19380576, PMC 2719340 (freier Volltext).
This article is issued from Wikipedia. The text is licensed under Creative Commons - Attribution - Sharealike. Additional terms may apply for the media files.